Antineoplastic agents

Histone H2B type 1-C/E/F/G/I (UniProt: P62807 also known as Histone H2B.1 A, Histone H2B.

Histone H2B type 1-C/E/F/G/I (UniProt: P62807 also known as Histone H2B.1 A, Histone H2B.

Immunogen Recombinant protein corresponding to myelin protein zero Sequence AMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen mitochondrially encoded NADH dehydrogenase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Purified mouse monoclonal antibody. Recognizes the ~60 kDa MTI-MMP protein in overexpressing cells.

Immunogen myosin IB Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

The gene MYOM1 (myomesin 1) is mapped to human chromosome 18p11.31-p11.

Nuclear factor I A (NFIA) gene is located on the human chromosome 1p31.3.

Specificity Western blot analysis of transfected cells shows the antibody recognizes both NR2A and NR2B subunits equally. There may be a very slight recognition of NR2C and NR2D.

Specificity NMDAR2B, phosphoTyrosine1336. The antibody recognizes a protein of ~180 kDa corresponding to NMDAR2B, phosphoTyrosine1336 in lysates from rat brain hippocampus.

Immunogen nicotinamide N-methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the N terminal region of human NOBOX Biochem/physiol Actions NOBOX is a transcription factor which may play a role in oogenesis. It binds preferentially to the DNA sequences 5&#8242-TAATTG-3&#8242,