Antineoplastic agents

Rab11-family interacting protein 1 (Rab11-FIP1) is encoded by a gene mapped to human chromosome 8p11. The encoded protein is characterized with an amphipathic a-helix at carboxyl-terminal end involved in binding Rab11a.

Immunogen RAB11 family interacting protein 5 (class I) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Retinoic acid receptor responder protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Retinoic acid receptor responder (tazarotene induced) 3 (RARRES3, HRASLS4), a member of the steroid and thyroid hormone receptor superfamily of transcription factors, is induced by the synthetic retinoid tazarotene. RARRES3/TIG3 of the lecithin

Rabbit polyclonal anti-RAX (AB2) antibody reacts with bovine, canine, human, mouse, and rat retina and anterior neural fold homeobox factors. Retina and anterior neural fold homeobox (RAX) is a paired-type homeobox gene expressed in the anterior

The gene RBFOX1 (RNA binding protein, fox-1 homolog 1) is mapped to human chromosome 16p13.3.

Immunogen Synthetic peptide directed towards the middle region of human RG9MTD2 Sequence Synthetic peptide located within the following region: EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA Physical form Purified antibody supplied in 1x PBS

Immunogen X-linked retinitis pigmentosa GTPase regulator recombinant protein epitope signature tag (PrEST) Application Anti-RPGR antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 (UniProt: Q9EPQ2 also known as RPGR-interacting protein 1 RPGRIP1) is encoded by the Rpgrip1 gene (Gene ID 77945) in mouse species. RPGRIP is expressed in rod and cone

Immunogen Recombinant protein corresponding to scavenger receptor class B member 1 Sequence CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Secretogranin-3 precursor recombinant protein epitope signature tag (PrEST) Application Anti-SCG3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Secretogranin-5 (SCG5) is present in cells which contain secretory granules, such as neurons and endocrine cells. The gene encoding this protein is located on chromosome 15q13-q14.