-
Add to Cart The item has been addedHPA020872-100ULAnti-SFXN4 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene SFXN4 (sideroflexin-4) is mapped to human chromosome 10q25-26. It is widely expressed. -
Add to Cart The item has been addedHPA015473-100ULAnti-SFXN5 antibody produced in rabbit (C15-1448-342)
Price: $879.43List Price: $977.14SFXN5 (sideroflexin 5) is localized to human chromosome 2p13, and the cDNA is 4191bp in size. It codes for a protein composed of 340 amino acids, which has a predominant expression in the brain. -
Add to Cart The item has been addedHPA056866-100ULAnti-SFXN5 antibody produced in rabbit (C15-1462-480)
Price: $928.29List Price: $1,031.43Immunogen sideroflexin 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA021125-25ULANTI-SGPL1
Price: $540.00List Price: $600.00The gene SGPL1 (sphingosine-1-phosphate lyase 1) is mapped to human chromosome 10q22. It is strongly expressed in the liver. -
Add to Cart The item has been addedHPA045245-25ULANTI-SIK3
Price: $540.00List Price: $600.00Immunogen SIK family kinase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA069319-100ULAnti-SLAMF1
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to signaling lymphocytic activation molecule family member 1 Sequence KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedAV45417-100ULANTI-SMPD2
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human SMPD2 Application Anti-SMPD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml. -
Add to Cart The item has been addedHPA022023-100ULANTI-SPATA20
Price: $879.43List Price: $977.14Immunogen Spermatogenesis-associated protein 20 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA036451-25ULANTI-SPATA5
Price: $540.00List Price: $600.00Immunogen spermatogenesis associated 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA026852-100ULAnti-SPINT3
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to serine peptidase inhibitor, Kunitz type 3 Sequence DTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA046703-100ULAnti-SPINT4
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to serine peptidase inhibitor, Kunitz type 4 Sequence KICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedDR1057-100UGAnti-SQSTM1 Mouse mAb (2C11)
Price: $819.72List Price: $910.80Purified mouse monoclonal antibody. Recognizes the SQSTM1 protein.
