Antineoplastic agents

Troponin T type 2 (TNNT2) is a sarcomeric thin-filament contractile protein. The gene encoding this protein is localized on chromosome 1q32 and consists of 16 exons.

Immunogen thyroid hormone receptor interactor 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen thyroid hormone receptor interactor 12 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the middle region of human TRIP4 Biochem/physiol Actions TRIP4, also referred to as human activating signal cointegrator 1 (hASC-1), is a transcriptional coactivator of nuclear receptors. The ASC-1

Specificity Recognizes Tropomyosin 5NM1 and 5NM2. Immunogen Epitope: 5NM1 and 5NM2 Synthetic peptide corresponding to the 9d exon from the gamma gene of tropomyosin.

Immunogen transient receptor potential cation channel, subfamily M, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen transient receptor potential cation channel, subfamily M, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

TRPM4, also known as Calcium-activated non-selective cation channel 1, Long transient receptor potential channel 4, Melastatin-4 or LTrpC4, and encoded by the gene TRPM4/LTRPC4, is a calcium activated non-selective ion channel for Na+, K+, Cs+ and

UBTF (upstream binding transcription factor) is composed of six HMG box domains, which are lined up consecutively. It also contains a dimerization and a transactivation domain.

ULK2 (unc-51 like autophagy activating kinase 2) is an autophagy inducer gene. This protein is a mammalian homolog of the yeast Saccharomyces cerevisiae protein autophagy-related proteins (ATGs).

Immunogen Recombinant protein corresponding to urocanate hydratase 1 Sequence TDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEVINGGFGLVLDGTPEAEGRARLMLSWDVSNGV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen ubiquitin specific peptidase 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are