-
Add to Cart The item has been added10092320-1VLMM426 HUMAN MALIGNANT MELANOMA
Price: $1,630.29List Price: $1,811.43Cell Line Origin Human malignant melanoma Cell Line Description Malignant Melanoma. Cell Bank Australia reference number: CBA1352. -
Add to Cart The item has been added11072802-1VLMM576
Price: $1,630.29List Price: $1,811.43Cell Line Origin Human melanoma metastatic site lymph node Cell Line Description MM576 is a human melanoma derived from a metastatic site (lymph node). Cell Bank Australia reference number CBA-1357 Culture Medium RPMI 1640 (R0883) (with 2 mM L- -
Add to Cart The item has been added444250-10MGMMP Inhibitor I - Calbiochem (C15-1303-637)
Price: $450.00List Price: $500.00A tetrapeptidyl hydroxamic acid that inhibits MMP-1 and MMP-8 (IC 50 = 1.0 µM), MMP-9 (IC 50 = 30 µM) and MMP-3 (IC 50 = 150 µM). -
Add to Cart The item has been added90111911-1VLMMT-060562MOUSE C57BL X A/F1 MAMMARY TUMOUR (C15-1311-876)
Price: $1,407.43List Price: $1,563.81Cell Line Origin Mouse C57BL x A/F1 mammary tumour Cell Line Description Derived from a spontaneous mammary tumour which arose in a C57BL x A/F1 hybrid female mouse. Bittner virus has been revealed in the cells by electron microscopy. -
Add to Cart The item has been addedA96207-25Gmono-Methyl azelate
Price: $718.20List Price: $798.00mono-Methyl azelate -
Add to Cart The item has been addedAMAB91430-100ULMonoclonal Anti-PRL (C15-1318-848)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to prolactin Sequence TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedAMAB90706-25ULMONOCLONAL ANTI-SDHB (C15-1318-511)
Price: $540.00List Price: $600.00Immunogen Recombinant protein corresponding to succinate dehydrogenase complex, subunit B, iron sulfur (Ip). Sequence EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY Epitope Binds to an -
Add to Cart The item has been addedAMAB90966-25ULMONOCLONAL ANTI-TUFM (C15-1318-615)
Price: $540.00List Price: $600.00Monoclonal Anti-TUFM Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Tu -
Add to Cart The item has been added1446848-20MGMontelukast racemate
Price: $2,521.98List Price: $2,802.20This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the -
-
Add to Cart The item has been added8691001Mouse Anti-Actin, Monoclonal (Clone: C4) 100æl
Price: $499.52List Price: $555.02Actin Monoclonal Antibody was used for western blot analysis of Cos-7 cell lysates to ensure equal protein loading. Western blot analysis of MDCK cell lysates were performed using monoclonal anti-actin antibody as a primary antibody. -
Add to Cart The item has been added8691002Mouse Anti-Actin, Monoclonal (Clone: C4) 200æl
Price: $932.53List Price: $1,036.14Actin Monoclonal Antibody was used for western blot analysis of Cos-7 cell lysates to ensure equal protein loading. Western blot analysis of MDCK cell lysates were performed using monoclonal anti-actin antibody as a primary antibody.
