Alemtuzumab

The protein called Friend of PRMT1 (FOP), or more correctly Chromatin target of PRMT1 protein, or Small arginine and glycine rich protein (SRAG) is an important partner in estrogen receptor gene activation events and plays a role in 5FMC mediated

PNMT, also known as Phosphatidylethanolamine N-methyltransferase, or PEMT, PEAMT, or PEMT2, and encoded by the gene PEMT/PEMPT/PNMT, catalyzes three sequential methylation reactions of phosphatidylethanolamine to produce phosphatidylcholine a major

Immunogen Recombinant protein corresponding to succinate dehydrogenase complex, subunit B, iron sulfur (Ip). Sequence EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY Epitope Binds to an

Monoclonal Anti-TUFM Prestige Antibodies &#174 Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and Immunogen Tu

HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IHC-P, IF APPLICATIONS: ORMDL1 antibody can be used for detection of ORMDL1 by Western blot at 1 - 2 &#956g/mL. Antibody can also be used for immunohistochemistry starting at 5

PrEST Antigen SPINK5 serine peptidase inhibitor, Kazal type

Cell Line Origin Human myeloma Cell Line Description This cell line was derived from peripheral blood of a patient with an IgE myeloma (epsilon2,lambda2). The line has been reported to secrete IgE and is used as fusion partner for the production of