-
Add to Cart The item has been added436844-5G3-Thienylboronic acid (C15-1253-242)
Price: $164.10List Price: $182.34Other Notes Contains varying amounts of anhydride -
Add to Cart The item has been added75934-10MG3beta-Taraxerol
Price: $814.29List Price: $904.76Application Refer to the product′s Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support. -
Add to Cart The item has been added487767-10GAcetaldehyde-2,2,2-d3 (C15-1221-808)
Price: $5,917.58List Price: $6,575.09Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been added487767-1GAcetaldehyde-2,2,2-d3 (C15-1221-809)
Price: $790.29List Price: $878.10Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been added487767-5GAcetaldehyde-2,2,2-d3 (C15-1221-810)
Price: $3,296.70List Price: $3,663.00Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been added233323-10X0.5MLACETONITRILE-D3 100 (MIN. 99.96 ATOM % D) (C15-1223-789)
Price: $170.09List Price: $188.99Acetonitrile-d 3 is (Trideuteroacetonitrile, CD 3 CN) is a deuterated form of acetonitrile. It is 100% isotopically enriched NMR (nuclear magnetic resonance) solvent. -
Add to Cart The item has been added233323-25GACETONITRILE-D3 100 (MIN. 99.96 ATOM % D) (C15-1223-791)
Price: $822.86List Price: $914.29Acetonitrile-d 3 is (Trideuteroacetonitrile, CD 3 CN) is a deuterated form of acetonitrile. It is 100% isotopically enriched NMR (nuclear magnetic resonance) solvent. -
Add to Cart The item has been added233323-5GACETONITRILE-D3 100 (MIN. 99.96 ATOM % D) (C15-1223-792)
Price: $165.17List Price: $183.52Acetonitrile-d 3 is (Trideuteroacetonitrile, CD 3 CN) is a deuterated form of acetonitrile. It is 100% isotopically enriched NMR (nuclear magnetic resonance) solvent. -
Add to Cart The item has been addedAV42237-100ULANTI-IDH3A
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human IDH3A Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1 paper) -
Add to Cart The item has been addedHPA069497-25ULANTI-MGMT
Price: $540.00List Price: $600.00Immunogen Recombinant protein corresponding to O-6-methylguanine-DNA methyltransferase Sequence KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA036443-25ULANTI-NR1H3
Price: $540.00List Price: $600.00Immunogen nuclear receptor subfamily 1, group H, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedABE1456Anti-NR4A3 (C15-1316-940)
Price: $576.00List Price: $640.00Nuclear receptor subfamily 4 group A member 3 (UniProt: Q92570 also known as NR4A3, Mitogen-induced nuclear orphan receptor, Neuron-derived orphan receptor 1, Nuclear hormone receptor NOR-1) is encoded by the NR4A3 (also known as CHN, CSMF, MINOR,
