-
Add to Cart The item has been addedHPA006880-25ULANTI-SCG3
Price: $540.00List Price: $600.00Immunogen Secretogranin-3 precursor recombinant protein epitope signature tag (PrEST) Application Anti-SCG3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
Add to Cart The item has been addedHPA045245-25ULANTI-SIK3
Price: $540.00List Price: $600.00Immunogen SIK family kinase 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA026852-100ULAnti-SPINT3
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to serine peptidase inhibitor, Kunitz type 3 Sequence DTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been added140105-10GAntimony lump, polycrystalline, 99.9999% trace metals basis (C08-0281-945)
Price: $167.36List Price: $185.96CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added140105-50GAntimony lump, polycrystalline, 99.9999% trace metals basis (C08-0288-419)
Price: $498.92List Price: $554.35CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added213314-5GAntimony(III) ethoxide
Price: $248.57List Price: $276.19Antimony(III) ethoxide -
Add to Cart The item has been added202649-10GAntimony(III) oxide (C15-1210-958)
Price: $225.00List Price: $250.00Application Selective ammoxidation catalysts for such reactions as conversion of toluene to benzonitrile or propylene to acrylonitrile were prepared by a sol-gel method from V 2 O 5 , Sb 2 O 3 and high purity hydrogen peroxide. Features and -
Add to Cart The item has been added202649-50GAntimony(III) oxide (C15-1210-959)
Price: $627.43List Price: $697.14Application Selective ammoxidation catalysts for such reactions as conversion of toluene to benzonitrile or propylene to acrylonitrile were prepared by a sol-gel method from V 2 O 5 , Sb 2 O 3 and high purity hydrogen peroxide. Features and -
Add to Cart The item has been added230898-100GAntimony(III) oxide (C15-1210-960)
Price: $94.91List Price: $105.45Legal Information ReagentPlus is a registered trademark of Sigma-Aldrich Co. LLC -
Add to Cart The item has been added230898-1KGAntimony(III) oxide (C15-1210-961)
Price: $310.41List Price: $344.90Legal Information ReagentPlus is a registered trademark of Sigma-Aldrich Co. LLC -
Add to Cart The item has been added379255-50GAntimony(III) oxide (C15-1210-962)
Price: $519.43List Price: $577.14Application Selective ammoxidation catalysts for such reactions as conversion of toluene to benzonitrile or propylene to acrylonitrile were prepared by a sol-gel method from V 2 O 5 , Sb 2 O 3 and high purity hydrogen peroxide. -
Add to Cart The item has been added637173-100GAntimony(III) oxide (C15-1210-963)
Price: $319.29List Price: $354.76Antimony(III) oxide
