Axitinib

Immunogen AXL receptor tyrosine kinase recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1

Immunogen Recombinant protein corresponding to cilia and flagella associated protein 53 Sequence QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD Application All Prestige Antibodies Powered by Atlas

Immunogen Synthetic peptide directed towards the C terminal region of human DLX5 Biochem/physiol Actions DLX5 is a member of a homeobox transcription factor family. DLX5 may play a role in bone development and fracture healing.

Anti-ULK2 unc-51 like autophagy activating kinase 2, 100ul U

Biochem/physiol Actions Protein Target: Axl Target Sub-Family: TK Quality Routinely evaluated by for use as a substrate in protein kinase assay. Physical form Lyophilized powder Storage and Stability 2 years at -20&#176C Legal Information UPSTATE

Legal Information AxyPet is a registered trademark of Axygen, Inc. Axygen is a registered trademark of Corning, Inc.

Mse A-Ckn CD45-AF488 0.1 mg

Cell Line Origin Human small cell lung cancer, drug-resistant Cell Line Description NCI-H69/CPR is a drug resistant subline of NCI-H69 (Sigma Catalogue number. 91091802).

Novaluron (Rimon) is a type of benzoylphenyl urea,3 that acts as an insect growth regulator by inhibiting chitin synthesis. It acts as a powerful toxicant for controlling lepidopteran larvae.

This certified reference material (CRM) is produced and certified in accordance with ISO/IEC 17025 and ISO 17034 . This CRM is traceable to primary material from an NMI, e.