Bosutinib

(+)-N-Boc-L-alpha-phenylglycinol

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Immunogen Recombinant protein corresponding to barttin CLCNK type accessory beta subunit Sequence QPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACS Application All Prestige Antibodies Powered by Atlas Antibodies

Bactenecin is an antimicrobial peptide isolated from bovine neutrophils. Bactenecin is synthesized by solid-phase peptide synthesis and renatured to a fully disulfide-bonded form.

Application Biotin-PEG4-alkyne may be used for the modification of 4-azidophenylalanine (AzPhe) silk fibroin via bioorthogonal azide–alkyne cycloaddition reaction for developing photopatternable protein material. Biotinylation reagent for

Application Biotin-PEG4-alkyne may be used for the modification of 4-azidophenylalanine (AzPhe) silk fibroin via bioorthogonal azide–alkyne cycloaddition reaction for developing photopatternable protein material. Biotinylation reagent for

Application Reactant involved in synthesis of: Muramyldipeptide analogs via solid-phase synthesis Microcin C analogs for use as antibacterials Lipid I and nucleoside diphosphate peptide derivatives via N -methylimidazolium chloride catalyzed

Boc-Asn-OH

Boc-beta-Ala-OH

Boc-beta-Ala-OH

Boc-beta-Ala-OH

Standard building block for introduction of cysteine amino-acid residues by Boc SPPS. Associated Protocols and Technical Articles Cleavage and Deprotection Protocols for Boc SPPS Fmoc SPPS of Cysteine-Containing Peptides Linkage Replaces: