Fosfestrol

The development of the anti-phosphotyrosine, clone 4G10 in 1989 was a monumental discovery for researchers. 4G10 was the first and best single monoclonal antibody for the detection tyrosine phosphorylation.

Facio-genital dysplasia protein (FGD1) is an upstream regulator of Rho GTPases and is involved in the normal development of embryos . It is also known to function as a guanine-nucleotide exchange factor which is specific for Cdc42Hs .

Immunogen FYVE, RhoGEF and PH domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to fibroblast growth factor 11 Sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to fibroblast growth factor 11 Sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to fibroblast growth factor 9 Sequence MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Fos-related antigen 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Fusarenon X is a trichothecene mycotoxin isolated from Fusarium nivale . Application Fusarenon X may be used as a reference standard for the determination of fusarenon X in barley, wheat and corn samples by high-performance thin-layer

Certan Vial Fusarenon X, is a trichothecene mycotoxin , which is produced by Fusarium nivale fungi , naturally occurring in crops such as wheat and barley. Application Refer to the product&#8242s Certificate of Analysis for more information on a

A cell-permeable oxodihydroquinoline that preferentially inhibits the transcription activity of Forkhead box O family member Foxo1 over that of the functionally related Foxo3a and Foxo4 (70%, 20%, and 3% inhibition, respectively, in HepG2-based

Application PEG-SS-PCL is a redox responsive, biocompatible, amphiphilic block copolymer composed of a hydrophilic poly(ethylene glycol) (PEG) block and a hydrophobic poly(&#949-caprolactone) (PCL) block , with a reducible disulfide linkage