Galocitabine

&beta-Gal-NONOate is a nitric oxide (NO) donor which releases NO following activation by &beta-galactosidase. &beta-Gal-NONOate is stabile in aqueous solution at neutral and acidic pH for several hours, exhibits good water solubility, and is able

Immunogen Recombinant protein corresponding to galactose mutarotase Sequence DVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to galactosamine (N-acetyl)-6-sulfatase Sequence TTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKK Application All Prestige Antibodies Powered by Atlas Antibodies

GALNT13 is particularly expressed in fetal brain, adult cerebellum, cerebral cortex and whole brain. GALNT13 transcripts are exclusively present in neuroblastoma cells.

GALNT2 (polypeptide N -acetylgalactosaminyltransferase 2) belongs to the ppGalNAc-T family, and is a type II transmembrane protein. The catalytic domain resides in the Golgi luminal region, and the R-type lectin domain lies in the C-terminal.

Immunogen polypeptide N-acetylgalactosaminyltransferase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen polypeptide N-acetylgalactosaminyltransferase 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Specificity Note: The Ensemble Gene ID has changed from ENSG00000137070 in the 46:36 release of the database to ENSG00000213930 in the 48:36 release of the database. Immunogen Galactose-1-phosphate uridylyltransferase recombinant protein epitope

Neuronal membrane glycoprotein M6-b is a protein encoded by the GPM6B gene in humans and is located at Xp22.2.

Application BFMO is a ligand for the copper-catalyzed coupling of aryl halides and nitrogen heterocycles. Other Notes Copper(I) Oxide/ N , N &#8242-Bis[(2-furyl)methyl]oxalamide-Catalyzed Coupling of (Hetero)aryl Halides and Nitrogen Heterocycles

Application BFMO is a ligand for the copper-catalyzed coupling of aryl halides and nitrogen heterocycles. Other Notes Copper(I) Oxide/ N , N &#8242-Bis[(2-furyl)methyl]oxalamide-Catalyzed Coupling of (Hetero)aryl Halides and Nitrogen Heterocycles

Produced and qualified by Indoor Biotechnologies. Source: Bovine thyroid gland Formulation: Preservative-free and carrier-free in phosphate buffered saline, pH 7.