-
Add to Cart The item has been addedH6012-25MG4-Hydroxyestrone (C15-1230-312)
Price: $1,638.86List Price: $1,820.95Biochem/physiol Actions 4-Hydroxyestrone is an endogenous estrogen metabolite, which exhibits a strong neuroprotective effect against oxidative damage. It also provides effective protection against kanic acid-induced hippocampal oxidative damage in -
Add to Cart The item has been addedH6012-5MG4-Hydroxyestrone (C15-1230-313)
Price: $444.49List Price: $493.88Biochem/physiol Actions 4-Hydroxyestrone is an endogenous estrogen metabolite, which exhibits a strong neuroprotective effect against oxidative damage. It also provides effective protection against kanic acid-induced hippocampal oxidative damage in -
Add to Cart The item has been addedAV46789-100ULANTI-LMAN2
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the C terminal region of human LMAN2 Application Anti-LMAN2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. -
Add to Cart The item has been addedHPA077070-100ULAnti-LMTK3
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to lemur tyrosine kinase 3 Sequence CSCLPLERGDAVAGWGGHPALGCPHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been added96020733-1VLCOR-L95 HUMAN LUNG SMALL CELL CARCINOMA (C15-1314-493)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Human lung small cell carcinoma Cell Line Description The cell line COR-L95 was established from a bronchial biopsy of a 64 year old male. Histology results were consistent with undifferentiated small cell carcinoma. -
Add to Cart The item has been addedC7505-10MGL-Cystathionine (C15-1249-257)
Price: $231.43List Price: $257.14Application L-Cystathionine has been used in ultra-performance liquid chromatography for the validation of cystathionine and the correlation of its abundance with vertebrate metamorphosis. It has also been used as an inhibitor of sinusoidal GSH -
Add to Cart The item has been addedC7505-250MGL-Cystathionine (C15-1249-258)
Price: $2,505.49List Price: $2,783.88Application L-Cystathionine has been used in ultra-performance liquid chromatography for the validation of cystathionine and the correlation of its abundance with vertebrate metamorphosis. It has also been used as an inhibitor of sinusoidal GSH -
Add to Cart The item has been addedC7505-50MGL-Cystathionine (C15-1249-259)
Price: $651.43List Price: $723.81Application L-Cystathionine has been used in ultra-performance liquid chromatography for the validation of cystathionine and the correlation of its abundance with vertebrate metamorphosis. It has also been used as an inhibitor of sinusoidal GSH
