Mitonafide

LCMT2 codes for leucine carboxyl methyltransferase 2 that belongs to the variable methyltransferase superfamily. Rabbit anti-LCMT2 antibody recognizes canine, human, and chicken LCMT2.

Immunogen Recombinant protein corresponding to serine peptidase inhibitor, Kunitz type 4 Sequence KICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Cell Line Description PEA2 is an adherent cell line derived from a malignant effusion from the peritoneal ascites of a patient with a poorly differentiated adenocarcinoma. PEA2 was collected on relapse after treatment with cisplatin and