-
Add to Cart The item has been added219606480(-)-Epigallocatechin gallate, 100 mg
Price: $354.40List Price: $393.77Potent anticancer compound. Anti-angiogenic. -
Add to Cart The item has been added219606425(-)-Epigallocatechin gallate, 25 mg
Price: $160.74List Price: $178.60Potent anticancer compound. Anti-angiogenic. -
Add to Cart The item has been addedA7505-1G1,4-Androstadiene-3,17-dione (C15-1289-511)
Price: $483.06List Price: $536.731,4-Androstadiene-3,17-dione is a 17-keto anabolic steroid. Biochem/physiol Actions 1,4-Androstadiene-3,17-dione is a prohormone that converts to an active steroid through the 17bHSD enzyme. -
Add to Cart The item has been addedA7505-5G1,4-Androstadiene-3,17-dione (C15-1289-512)
Price: $1,714.29List Price: $1,904.761,4-Androstadiene-3,17-dione is a 17-keto anabolic steroid. Biochem/physiol Actions 1,4-Androstadiene-3,17-dione is a prohormone that converts to an active steroid through the 17bHSD enzyme. -
Add to Cart The item has been addedHPA078300-100ULAnti-CPNE4
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to copine 4 Sequence AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been added55335Anti-PEMT (C-terminus); 100 æg
Price: $1,164.17List Price: $1,293.53This PEMT antibody is validated for use in WB, ICC & ELISA for the detection of the PEMT protein.
