Pralatrexate

Immunogen Synthetic peptide directed towards the C terminal region of human PRPF6 Biochem/physiol Actions PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the

Paired related homeobox 2 (PRRX2) is a member of PRRX gene family, which is encoded by a gene mapped to human chromosome 9q34.1.

Immunogen protease, serine, 54 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Synthetic peptide directed towards the N terminal region of human SMPD2 Application Anti-SMPD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25&#956g/ml.

Clear, Colorless Liquid Synonyms: Oxybis(trimethylsilane), HMDSO CAS Number: 107-46-0 Molecular Formula: C6H18OSi2 Molecular Weight: 162.4 Beilstein Registry Number: 1736258 EC Number: 203-492-7 MDL Number: MFCD00008265

Immunogen Recombinant protein corresponding to prolactin Sequence TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

PAX-8 is a transcription factor expressed during embryonic development of M&#252llerian organs, kidneys, and thyroid, with continued expression in some epithelial cell types of these mature tissues. PAX-8 is a useful marker for neoplasms of

Application Pr-DMQA[BF 4 ] is an organic photoredox catalyst for red-light mediated photoreductions and photooxidations. Product can be used with our line of photoreactors : Including Penn PhD ( Z744035 ) &amp SynLED 2.

Application Pr-DMQA[BF 4 ] is an organic photoredox catalyst for red-light mediated photoreductions and photooxidations. Product can be used with our line of photoreactors : Including Penn PhD ( Z744035 ) &amp SynLED 2.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Pr₂(SO₄)₃&bull8H₂O CAS#: 10277-44-8 F.W.: 714.14

Pr(CF₃SO₃)₃ CAS#: 52093-27-3 F.W.: 588.11