Sarcolysin

Cell Line Origin Human glioblastoma Cell Line Description Derived from a glioblastoma removed from a 53 year old male. Non-tumourigenic in anti-thymocyte serum treated NIH Swiss mice.

Cell Line Origin Mouse P3X63Ag8.653 x Mouse BALB/c spleen Cell Line Description The antibody is directed against a 188kDa polypeptide present on the basolateral plasma membrane of Madin-Darby canine kidney (MDCK) cells.

Immunogen Recombinant protein corresponding to signaling lymphocytic activation molecule family member 1 Sequence KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE Application All Prestige Antibodies Powered by Atlas

The bradykinin (BK) fragment (1-5) (RPPGF) is among the most stable of naturally occurring metabolites. Bradykinin (1-5) may be used as a marker for BK production in vivo .

Cell Line Origin Human Caucasian colon adenocarcinoma Cell Line Description COLO 201, COLO 205 and COLO 206 (ECACC Catalogue 93052620) were all established from the ascites fluid obtained from a 70-year-old male patient with adenocarcinoma of the

Cell Line Origin Human malignant melanoma Cell Line Description Derived from a brain metastasis of a 62 year old male with melanoma. The cells bleb during culture.

Gly-Sar

Gly-Sar

Cell Line Origin Rat sarcoma, asparagine requiring Cell Line Description Used in studies relating to amino acid requirements and L-asparagine metabolism. Cloning studies show that variants not requiring L-asp are present in 100 per 1,000,000 cells

Cell Line Origin Mink lung, Moloney murine sarcoma virus infected Cell Line Description A clone of the mink lung cell line Mv.1.

PrEST Antigen PTGFRN prostaglandin F2 receptor inhibitor, 10

Sarcosine