Teniposide

Analysis Note Assay (HPLC, area%): &#8805 98.0 % (a/a) Melting range (lower value): &#8805 247 &#176C Melting range (upper value): &#8804 252 &#176C Identity (IR): passes test

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

9,10-Dibromoanthracene is an aryl dihalide compound widely used as a precursor to synthesize various organic compounds.

9,10-Dibromoanthracene is an aryl dihalide compound widely used as a precursor to synthesize various organic compounds.

Cell Line Description The antibody is directed against isopentenyl adenosine. In addition it reacts with a range of other cytokines and related compounds.

Expansion of a GGGGCC (G4C2) hexanucleotide repeat sequence in the non-coding region of human chromosome 9 open reading frame 72 or C9orf72 (also known as ALSFTD, FTDALS Gene ID 203228) is the most common genetic abnormality in familial and

Immunogen Synthetic peptide directed towards the middle region of human RG9MTD2 Sequence Synthetic peptide located within the following region: EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA Physical form Purified antibody supplied in 1x PBS

Specificity Recognizes Tropomyosin 5NM1 and 5NM2. Immunogen Epitope: 5NM1 and 5NM2 Synthetic peptide corresponding to the 9d exon from the gamma gene of tropomyosin.

MF: C15H12O MF: 208.26 CAS: 94-41-7 Purity: 0.99

Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service .

Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service .

DITHIZONE (Diphenylthiocarbazone), 10g