Trastuzumab

Cell Line Origin Human bone osteosarcoma TK- Cell Line Description Cells are thymidine kinase deficient (TK-) and resistant to BUdR.143B and HOS (Sigma Catalogue number 87070202) originated from the same host: 143B is TK- and originated indirectly

Immunogen Recombinant protein corresponding to scavenger receptor class B member 1 Sequence CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen transient receptor potential cation channel, subfamily M, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen transient receptor potential cation channel, subfamily M, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

TRPM4, also known as Calcium-activated non-selective cation channel 1, Long transient receptor potential channel 4, Melastatin-4 or LTrpC4, and encoded by the gene TRPM4/LTRPC4, is a calcium activated non-selective ion channel for Na+, K+, Cs+ and

Cell Line Origin Human glioblastoma Cell Line Description Derived from an adult female with glioblastoma multiforme treated with local brain irradiation and multi drug chemotherapy. By flow cytometry these cells were almost 100% positive for MHC

PrEST Antigen TNIK TRAF2 and NCK interacting kinase, 100ul U

A cell-permeable thiophene carboxymide derived compound that acts as a direct and selective antagonist of TrkB receptor. Binds to the high affinity site on the extracellular domain of TrkB in a dose-dependent manner (K d = 10 nM) exhibiting much