Uredepa

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Immunogen Recombinant protein corresponding to urocanate hydratase 1 Sequence TDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEVINGGFGLVLDGTPEAEGRARLMLSWDVSNGV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Application Reactant for preparation of: Acylated harmalines via Friedel-Crafts reaction Phenacyl derivatives of 1-methyl-7-methoxy-&#946-carbolines as central nervous system affectors Palladium harmaline DMSO chloro complex as anti-tumor agent

KOVA-Trol I - High Abnormal w/ Urobilinogen Assignment - 4 x 15mL

KOVA-Trol I - High Abnormal w/ Urobilinogen Assignment - 4 x 60mL

KOVA-Trol I - High Abnormal w/ Urobilinogen Assignment - 8 x 60mL

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of rare and unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Cell Line Origin Human bladder carcinoma epithelial Cell Line Description A slow growing tumour which does not form colonies in soft agar. Tumorigenic in nude mice, RT1112/84 cells possess a low plating efficiency requiring 400 cells/dish to form

Analysis Note Identity (UV/VIS-Spectrum): passes test Appearance: Reddish-brown powder, eventually with granular and bright parts. Absorption maximum &#955 max.

Analysis Note Identity (UV/VIS-Spectrum): passes test Appearance: Reddish-brown powder, eventually with granular and bright parts. Absorption maximum &#955 max.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including MSDS and any product information leaflets have been developed and issued under the Authority of the

Uridine is one of the four basic components of ribonucleic acid (RNA) the other three are adenosine, guanosine, and cytidine. Upon digestion of foods containing RNA, uridine is released from RNA and is absorbed intact in the gut.