Antipsychotics

Amlodipine EP Impurity D.

Alpha-synuclein is encoded by the SNCA gene (also known as NACP, PARK1) in human. There are two other known synuclein family members, beta- and gamma-synuclein.

Immunogen Recombinant protein corresponding to cilia and flagella associated protein 70 Sequence DLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKE Application All Prestige Antibodies Powered by Atlas Antibodies are

Cytochrome P450 (CYP) is a huge and diverse superfamily of hemoproteins. It metabolize the fatty acid arachidonic acid (AA) to regulators of vascular tone.

Immunogen farnesyl diphosphate synthase (farnesyl pyrophosphate synthetase, dimethylallyltranstransferase, geranyltranstransferase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies

Formins contain a conserved formin homology 2 (FH2) domain that is essential for dimerization and subsequent actin filament assembly. N-terminal to this domain is the formin homology 1 (FH1) domain that functions in the physiological action of

FMNL (formin like) encodes a formin homology protein. It belongs to the formin family with three other members: FMNL1, FMNL2 and FMNL3.

Anti-GABA(A) Receptor beta 3 pS408/pS409 (Rabbit) antibody is suitable for use in Western Blotting. Specific conditions for reactivity should be optimized by the end user.

Anti-GABA(A) Receptor gamma 2 pS327 (Rabbit) antibody is suitable for use in Western Blotting. Specific conditions for reactivity should be optimized by the end user.

Glutamate decarboxylase 2/Glutamate decarboxylase 1 (UniProt: Q05329/Q99259 also known as 65 kDa/67kDa glutamic acid decarboxylase, GAD-65/67, Glutamate decarboxylase 65/67 kDa isoform) is encoded by GAD2/GAD1 (also known as GAD65/GAD67) gene

Glutamate decarboxylase 2/Glutamate decarboxylase 1 (UniProt: Q05329/Q99259 also known as 65 kDa/67kDa glutamic acid decarboxylase, GAD-65/67, Glutamate decarboxylase 65/67 kDa isoform) is encoded by GAD2/GAD1 (also known as GAD65/GAD67) gene

Immunogen LSM11, U7 small nuclear RNA associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,