-
Add to Cart The item has been added603805-1GAcetaldehyde-1-13C (C15-1223-627)
Price: $6,527.47List Price: $7,252.75Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been added603805-500MGAcetaldehyde-1-13C (C15-1223-628)
Price: $3,939.56List Price: $4,377.29Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been addedA-203-100MGACETALDEHYDE-2 4-DNPH
Price: $831.43List Price: $923.81Legal Information CERILLIANT is a registered trademark of Cerilliant Corporation Snap-N-Shoot is a registered trademark of Cerilliant Corporation Snap-N-Spike is a registered trademark of Cerilliant Corporation -
Add to Cart The item has been addedCRM47340Acetaldehyde-2,4-DNPH solution (C15-1200-097)
Price: $81.58List Price: $90.65Application Refer to the product′s Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support. -
Add to Cart The item has been addedCRM4M7340Acetaldehyde-2,4-DNPH solution (C15-1200-098)
Price: $293.57List Price: $326.19Application Refer to the product′s Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support. -
Add to Cart The item has been added176567-10GAcetaldehyde-d4 (C15-1218-465)
Price: $1,796.70List Price: $1,996.34Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been added176567-1GAcetaldehyde-d4 (C15-1218-466)
Price: $295.71List Price: $328.57Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been added176567-5GAcetaldehyde-d4 (C15-1218-467)
Price: $982.29List Price: $1,091.43Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service . -
Add to Cart The item has been addedERA-028-1.2MLAldehyde/Ketone-DNPH Stock Standard-13
Price: $131.24List Price: $145.82Legal Information CERILLIANT is a registered trademark of Cerilliant Corporation Snap-N-Shoot is a registered trademark of Cerilliant Corporation Snap-N-Spike is a registered trademark of Cerilliant Corporation -
Add to Cart The item has been added923850-2GALGINATE ALDEHYDE 20% ALDEHYDE CONTENT MEDIUM VISCOSITY (C15-1313-134)
Price: $490.41List Price: $544.90Application Alginate is an anionic polysaccharide that is widely used in pharmaceutical and biomedical applications due to its non-animal origin, low toxicity, biocompatibility, and biodegradability . Alginate hydrogels are commonly used to -
Add to Cart The item has been added923842-2GALGINATE ALDEHYDE 35% ALDEHYDE CONTENT MEDIUM VISCOSITY (C15-1313-133)
Price: $490.41List Price: $544.90Application Alginate is an anionic polysaccharide that is widely used in pharmaceutical and biomedical applications due to its non-animal origin, low toxicity, biocompatibility, and biodegradability[1]. Alginate hydrogels are commonly used to -
Add to Cart The item has been addedAV41106-100ULANTI-ALKBH8
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ALKBH8 Sequence Synthetic peptide located within the following region: MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG Physical form Purified antibody supplied in 1x PBS
