Antiseptic cresols

Cysteine-rich protein 2 (CRIP2) is a LIM-domain protein that can function as a transcriptional repressor of NF-&#954B-mediated expression of proangiogenic cytokines. Hence, CRIP2 can inhibit angiogenesis and cancer formation .

Immunogen Recombinant protein corresponding to secretogranin II Sequence NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Creatinine is excreted at fairly constant rates in the absence of renal disease and commonly used as benchmark in urinary biomarker analysis. Serum creatinine levels are useful indicators of renal function and have been implicated in diabetes,

Application m -Cresol can be used as a starting material to synthesize: Thymol via isopropylation reaction with 2-propanol in the presence of an acid catalyst. Terpolymeric resin by an acid-catalyzed polycondensation reaction with hexamine and

Application m -Cresol can be used as a starting material to synthesize: Thymol via isopropylation reaction with 2-propanol in the presence of an acid catalyst. Terpolymeric resin by an acid-catalyzed polycondensation reaction with hexamine and

o -Cresol is a phenol derivative and an isomer of cresol. It is commercially used as a component of disinfectants and cleaning agents.

Legal Information ReagentPlus is a registered trademark of Sigma-Aldrich Co. LLC

Legal Information ReagentPlus is a registered trademark of Sigma-Aldrich Co. LLC

Legal Information ReagentPlus is a registered trademark of Sigma-Aldrich Co. LLC

Legal Information ReagentPlus is a registered trademark of Sigma-Aldrich Co. LLC

Application o -Cresol can be used as a starting material to synthesize: Carvacrol by alkylation reaction with propylene or isopropyl alcohol in the presence of Zr/mesoporous silica as a catalyst. Polyisobutylenes by selective cationic

Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service .