-
HPA069443-100ULImmunogen Recombinant protein corresponding to myristoylated alanine rich protein kinase C substrate Sequence MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the
-
33017
benzaldehyde, 2,000æg/mL, methylene chloride, 1mL/ampul
Price: $71.70List Price: $79.66Compound List Benzaldehyde (100-52-7) -
-
12060-100GAnalysis Note Titration 360 eq.wt (+/-30) with HCLO 4
-
12060-1KGAnalysis Note Titration 360 eq.wt (+/-30) with HCLO 4
-
12060-500GAnalysis Note Titration 360 eq.wt (+/-30) with HCLO 4
-
12060-5GAnalysis Note Titration 360 eq.wt (+/-30) with HCLO 4
-
1371231000Finding the right excipient that matches your needs as well as regulatory demands can be a complicated challenge in formulation. With our application know-how and regulatory expertise, we support you in every step of development, scale-up, and
-
B6295-100GBenzalkonium chloride is a cationic detergent that is a member of quaternary ammonium compounds (QACs). Application Benzalkonium chloride has been used in a study to assess its action on epithelia conjunctival cells in vitro .
-
B6295-500GBenzalkonium chloride is a cationic detergent that is a member of quaternary ammonium compounds (QACs). Application Benzalkonium chloride has been used in a study to assess its action on epithelia conjunctival cells in vitro .
-
1050993-5MLThis product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
1371241000Finding the right excipient that matches your needs as well as regulatory demands can be a complicated challenge in formulation. With our application know-how and regulatory expertise, we support you in every step of development, scale-up, and