Dodeclonium bromide

12-Bromo-1-dodecanol

12-Bromo-1-dodecanol

Application 2-Thienylmagnesium bromide is a Grignard reagent that can be used as a reactant to synthesize: 1-(2-thienyl)-carbinols by condensation reaction with aldehydes. Carbinols are further dehydrated to form 2-thienyl olefins.

Other Notes Storage below 25 degrees C may cause the formation of crystalline magnesium salts. Moving the container to a warm location and occasional gentle swirling should redissolve the solid.

Legal Information Product of Rieke Metals, Inc. Rieke is a registered trademark of Rieke Metals, Inc.

Application 3,5-Dichlorophenylmagnesium bromide can be used: In one of the key synthetic steps for the preparation of non-alternant polycyclic hydrocarbon named indeno-benzophenalene. As a substrate in the synthesis of carboxylic esters by reacting

4-tert-Butylphenylmagnesium bromide solution

4-tert-Butylphenylmagnesium bromide solution

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Immunogen Recombinant protein corresponding to chromosome 11 open reading frame 63 Sequence YAKQVKEYNMKTLSILSKPQTEKTQKKSAIPRQKALEYAKTIPKPKPSNLTHQASKEQKNPTYAGKEESLPEISLLEI Application All Prestige Antibodies Powered by Atlas Antibodies are developed

C1orf124/Spartan, a protein that contains a PCNA-interacting peptide motif, called a PIP box, and a UBZ4 ubiquitin-binding domain, is involved in Rad18-mediated Proliferating Cell Nuclear Antigen (PCNA) ubiquitination and the regulation of DNA

Immunogen Uncharacterized protein C1orf127 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are