-
Add to Cart The item has been addedHPA019693-25ULANTI-LSP1
Price: $540.00List Price: $600.00LSP1 (Lymphocyte-specific protein 1) is a 47kDa F-actin binding phosphoprotein consisting of mainly two domains, an N-terminal acidic domain and a C-terminal basic domain. The basic domain further is composed of multiple conserved, putative -
Add to Cart The item has been addedHPA012640-25ULANTI-PAWR
Price: $540.00List Price: $600.00PRKC apoptosis WT1 regulator protein (PAWR) is a 32-amino acid protein with a leucine zipper domain at its carboxy terminus. The gene encoding it is located on chromosome 12q21. -
Add to Cart The item has been addedABC1466-100ULAnti-phospho DCC (Tyr1418) (C15-1316-652)
Price: $713.14List Price: $792.38Netrin receptor DCC (UniProt: Q63155 also known as Tumor suppressor protein DCC, Deleted in Colorectal Cancer) is encoded by the Dcc gene (Gene ID: 25311) in rat. Netrin receptor DCC is a single-pass type I membrane protein that serves as a -
Add to Cart The item has been addedABC1466-25ULAnti-phospho DCC (Tyr1418) (C15-1316-653)
Price: $323.27List Price: $359.18Netrin receptor DCC (UniProt: Q63155 also known as Tumor suppressor protein DCC, Deleted in Colorectal Cancer) is encoded by the Dcc gene (Gene ID: 25311) in rat. Netrin receptor DCC is a single-pass type I membrane protein that serves as a -
Add to Cart The item has been addedABT1760Anti-phospho-VE-Cadherin (Tyr685) (C15-1318-014)
Price: $874.29List Price: $971.43Cadherin-5 (UniProt P33151 also known as 7B4 antigen, CD144, Vascular endothelial cadherin, VE-Cad, VE-cadherin) is encoded by the CDH5 gene (Gene ID 1003) in human. Cadherins (calcium-dependent adhesion) are type-1 transmembrane proteins that -
Add to Cart The item has been addedHPA055813-100ULAnti-POLR2H
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to polymerase (RNA) II (DNA directed) polypeptide H. Sequence PTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been added810706Anti-Synaptophysin Polyclonal Antibody, 250 æl
Price: $835.01List Price: $927.79SPECIES: Rabbit Ig CLASS: IgG REAGENT: Serum IMMUNOGEN: Synthetic human synaptophysin SPECIFICITY: Reactive in human and rat POSITIVE CONTROL: Pancreas or Pheochromocytoma APPLICATIONS: Western Blot, Immunohistochemistry on Paraffin Sections: 1/300 -
Add to Cart The item has been added5337960001ASPARAGINE ENDOPEPTIDASE INHIBITOR AENK (C15-1305-141)
Price: $404.08List Price: $448.98An amino and carboxy-terminal blocked tetra peptide that acts as a specific, competitive inhibitor of the protease activity of asparagine endopeptidase (AEP), an enzyme that cleaves substrates on the C-terminal side of asparagine. Believed to act -
-
-
-
Add to Cart The item has been addedA0RT1030-25ZKNORR LINKER, 25GR
Price: $231.94List Price: $257.72Structure confirmed. Purity = 98%. Will ship with Certificate of Analysis (CoA)
