-
HPA019693-25ULLSP1 (Lymphocyte-specific protein 1) is a 47kDa F-actin binding phosphoprotein consisting of mainly two domains, an N-terminal acidic domain and a C-terminal basic domain. The basic domain further is composed of multiple conserved, putative
-
HPA012640-25ULPRKC apoptosis WT1 regulator protein (PAWR) is a 32-amino acid protein with a leucine zipper domain at its carboxy terminus. The gene encoding it is located on chromosome 12q21.
-
ABC1466-100ULNetrin receptor DCC (UniProt: Q63155 also known as Tumor suppressor protein DCC, Deleted in Colorectal Cancer) is encoded by the Dcc gene (Gene ID: 25311) in rat. Netrin receptor DCC is a single-pass type I membrane protein that serves as a
-
ABC1466-25ULNetrin receptor DCC (UniProt: Q63155 also known as Tumor suppressor protein DCC, Deleted in Colorectal Cancer) is encoded by the Dcc gene (Gene ID: 25311) in rat. Netrin receptor DCC is a single-pass type I membrane protein that serves as a
-
ABT1760Cadherin-5 (UniProt P33151 also known as 7B4 antigen, CD144, Vascular endothelial cadherin, VE-Cad, VE-cadherin) is encoded by the CDH5 gene (Gene ID 1003) in human. Cadherins (calcium-dependent adhesion) are type-1 transmembrane proteins that
-
HPA055813-100ULImmunogen Recombinant protein corresponding to polymerase (RNA) II (DNA directed) polypeptide H. Sequence PTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF Application All Prestige Antibodies Powered by Atlas Antibodies are
-
810706
Anti-Synaptophysin Polyclonal Antibody, 250 æl
Price: $835.01List Price: $927.79SPECIES: Rabbit Ig CLASS: IgG REAGENT: Serum IMMUNOGEN: Synthetic human synaptophysin SPECIFICITY: Reactive in human and rat POSITIVE CONTROL: Pancreas or Pheochromocytoma APPLICATIONS: Western Blot, Immunohistochemistry on Paraffin Sections: 1/300 -
5337960001
Sigma-Aldrich
ASPARAGINE ENDOPEPTIDASE INHIBITOR AENK (C15-1305-141)
Price: $404.08List Price: $448.98An amino and carboxy-terminal blocked tetra peptide that acts as a specific, competitive inhibitor of the protease activity of asparagine endopeptidase (AEP), an enzyme that cleaves substrates on the C-terminal side of asparagine. Believed to act -
00651-04BUFFR PH10 500ML OK NIST
-
00651-30BUFFR PH4 1L OK NIST
-
00651-02BUFFR PH7 500ML OK NIST
-
E9199-301Floor Grade, Single Use Instrument