-
Add to Cart The item has been addedAV54486-100ULAnti-ACADVL antibody produced in rabbit (C15-1341-906)
Price: $819.43List Price: $910.48Immunogen Synthetic peptide directed towards the N terminal region of human ACADVL Application Anti-ACADVL antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL. Biochem/physiol Actions The protein encoded -
Add to Cart The item has been addedHPA019006-100ULAnti-ACADVL antibody produced in rabbit (C15-1449-165)
Price: $879.43List Price: $977.14The gene ACADVL (acyl-CoA dehydrogenase, very long chain) is mapped to human chromosome 17p13.1. -
Add to Cart The item has been addedHPA020595-100ULAnti-ACADVL antibody produced in rabbit (C15-1449-646)
Price: $879.43List Price: $977.14Very long-chain specific acyl-CoA dehydrogenase (ACADVL) exists as a homodimer. It possesses around 180 amino acids at its C-terminal which helps it to bind to proteins. -
Add to Cart The item has been addedHPA060170-100ULAnti-ACOT2
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to acyl-CoA thioesterase 2 Sequence MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA025735-100ULAnti-ACOT7 antibody produced in rabbit (C15-1450-966)
Price: $879.43List Price: $977.14The gene ACOT7 (acyl-CoA thioesterase 7) is highly expressed in the brain and testis, and is mapped to human chromosome 1p36. This gene produces many isoforms due to alternate splicing. -
Add to Cart The item has been addedHPA025762-100ULAnti-ACOT7 antibody produced in rabbit (C15-1450-973)
Price: $879.43List Price: $977.14The gene ACOT7 (acyl-CoA thioesterase 7) is highly expressed in the brain and testis, and is mapped to human chromosome 1p36. This gene produces many isoforms due to alternate splicing. -
Add to Cart The item has been addedHPA048687-25ULANTI-ACR
Price: $540.00List Price: $600.00Immunogen acrosin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedAV53590-100ULANTI-ACRV1 (C15-1341-870)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ACRV1 Biochem/physiol Actions ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during -
Add to Cart The item has been addedHPA038718-25ULANTI-ACRV1 (C15-1455-409)
Price: $540.00List Price: $600.00Immunogen acrosomal vesicle protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA058869-25ULANTI-ACSBG1
Price: $540.00List Price: $600.00Immunogen acyl-CoA synthetase bubblegum family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedA2980-100ULAnti-AcV5 antibody, Mouse monoclonal (C15-1315-034)
Price: $828.00List Price: $920.00Anti-AcV5 antibody, Mouse monoclonal, (mouse IgG2b isotype) is derived from the hybridoma ACV5 produced by the fusion of mouse myeloma cells and splenocytes from C57Bl/6 X Balb/c mice immunized with AcNPV extracellular nonoccluded virus (NOV). GP64 -
Add to Cart The item has been addedA2980-200ULAnti-AcV5 antibody, Mouse monoclonal (C15-1315-035)
Price: $1,121.14List Price: $1,245.71Anti-AcV5 antibody, Mouse monoclonal, (mouse IgG2b isotype) is derived from the hybridoma ACV5 produced by the fusion of mouse myeloma cells and splenocytes from C57Bl/6 X Balb/c mice immunized with AcNPV extracellular nonoccluded virus (NOV). GP64
