Antiviral drugs

Anti-AcV5 antibody, Mouse monoclonal, (mouse IgG2b isotype) is derived from the hybridoma ACV5 produced by the fusion of mouse myeloma cells and splenocytes from C57Bl/6 X Balb/c mice immunized with AcNPV extracellular nonoccluded virus (NOV). GP64

Activin receptor type-1B (ACVR1B) is a member of the protein kinase superfamily, and more specifically to the TKL Ser/Thr protein kinase family and TGFB receptor subfamily. ACVR1B, also known as activin receptor-like kinase 4 (ALK4), is a type I

Activin receptor type-1 (ACVR1C) is a dimeric growth and differentiation factor belonging to the TKL Ser/Thr protein kinase family. Activins signal through a heteromeric complex of receptor serine kinases which include at least two, type I and two

ACVR1C (activin A receptor, type IC) gene is localized to human chromosome 2q24.1 and is abundantly expressed in human brain, pancreas and colon.

Immunogen Activin receptor type-1C precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen activin A receptor, type IIA recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the N terminal region of human ACVRL1 Application Anti-ACVRL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen Serine/threonine-protein kinase receptor R3 precursor recombinant protein epitope signature tag (PrEST) Application Anti-ACVRL1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Specificity Adenovirus, hexon assembly. No cross-reactivity with Para 1-3, Influenza A &amp B or RSV.

LPHN3 (latrophilin3) is a G-protein couple receptor (GRPC) belonging to the LPHN family. It is the major LPHN member expressed in brain, especially in cerebellum, cerebral cortex, amygdala, and caudate nucleus.

Aldo-keto reductase family 1, member B1 (AKR1B1) is part of the aldo/keto reductase superfamily. The gene encoding it is localized on human chromosome 7.

Immunogen Recombinant protein corresponding to arachidonate lipoxygenase 3 Sequence YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS Application All Prestige Antibodies Powered by Atlas Antibodies are developed