Antiviral drugs

The gene BRD9 (bromodomain-containing protein 9) is mapped to human chromosome 5p15.33.

Immunogen bromodomain containing 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Anti-Bromodeoxyuridine is a monoclonal antibody to 5-bromo-2&#8242-deoxyuridine-5&#8242-monophosphate. Specificity The antibody specifically binds to bromodeoxyuridine and crossreacts with iodouridine (10%).

Immunogen Recombinant protein corresponding to binder of sperm protein homolog 1 Sequence SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Recombinant protein corresponding to CDK2-associated, cullin domain 1. Sequence ASSTININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Calcium/calmodulin-dependent protein kinase kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen CaM kinase-like vesicle-associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Calmodulin-regulated spectrin-associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Catechol O-methyltransferase (EC 2.1.

The scaffolding protein is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting

Immunogen caveolin 1, caveolae protein, 22kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen caveolin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The