Antiviral drugs

Cell death activator CIDE-A (CIDE-A) binds to lipid droplets and regulates their enlargement which restricts lipolysis and favoring storage. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase

Claudin-7 is a member of a family of claudins that are tight junction integral membrane proteins with four transmembrane domains and two extracellular loops. Claudin-7 has been shown to be under-expressed in invasive ductal carcinomas and

Immunogen clavesin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen clavesin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen clavesin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen collagen, type I, alpha 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Collagen type VIII &#945 1 chain (COL8A1) is one of the two &#945 chains of type VIII collagen, which is involved in angiogenesis and artery remodeling. It is the major component of the Descemet′s membrane of the cornea.

Cubilin (UniProt O60494 also known as 460 kDa receptor, Intestinal intrinsic factor receptor, Intrinsic factor-cobalamin receptor, Intrinsic factor-vitamin B12 receptor) is encoded by the CUBN (also known as IFCR, MGA1) gene (Gene ID 8029) in

Immunogen Recombinant protein corresponding to cubilin Sequence SDQGFHITYLTSPSDLRCGGNYTDPEGELFLPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCGNGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGE Application All Prestige

Immunogen dentin matrix acidic phosphoprotein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the middle region of human DNER Application Anti-DNER antibody produced in rabbit is suitable for western blotting at a concentration of 5.0&#956g/ml.

Immunogen dipeptidyl-peptidase 10 (non-functional) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a