-
Add to Cart The item has been addedD3570-200ULAnti-DVL1 antibody produced in rabbit (C15-1355-705)
Price: $934.29List Price: $1,038.10The three DVL isoforms display high sequence homology and have conserved DIX, PDZ and DEP domains required for GSK3β inactivation. DVL1 is highly expressed in adult and fetal tissues such as skeletal muscle and pancreas but is also found in -
Add to Cart The item has been addedHPA073607-100ULANTI-DVL1 ANTIBODY PRODUCED IN RABBIT (C15-1466-404)
Price: $977.14List Price: $1,085.71Immunogen dishevelled segment polarity protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA021611-100ULAnti-DVL2 antibody produced in rabbit (C15-1449-942)
Price: $977.14List Price: $1,085.71Immunogen dishevelled segment polarity protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA022914-100ULAnti-DVL2 antibody produced in rabbit (C15-1450-171)
Price: $879.43List Price: $977.14Immunogen Segment polarity protein dishevelled homolog DVL-2 recombinant protein epitope signature tag (PrEST) Application Anti-DVL2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA064732-100ULAnti-DVL2 antibody produced in rabbit (C15-1464-711)
Price: $928.29List Price: $1,031.43Immunogen dishevelled segment polarity protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA058265-100ULAnti-DVL3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen dishevelled segment polarity protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA063001-25ULANTI-ELAVL2
Price: $540.00List Price: $600.00Immunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA042355-100ULAnti-ELOVL6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA053905-25ULANTI-EMC10
Price: $540.00List Price: $600.00Immunogen ER membrane protein complex subunit 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA017209-100ULAnti-ERV3-1
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to endogenous retrovirus group 3, member 1 Sequence QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA Application All -
Add to Cart The item has been addedHPA076115-100ULANTI-ERVV-1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen endogenous retrovirus group V member 1, envelope Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA002132-25ULANTI-ESYT2
Price: $540.00List Price: $600.00ESYT2 (extended synaptotagmin protein 2), membrane-anchored extended synaptotagmin-like protein, belongs to the family of multi-C 2 domain membrane proteins. It is composed of an N-terminal transmembrane domain, a central juxtamembranous domain and
