Antiviral drugs

Immunogen forkhead box O4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Fascin-1 or FSCN1 is an actin binding protein that is induced in mature dendritic cells. FSCN1 is not homologous to other actin-binding proteins and is not expressed in macrophages and neutrophils.

Anti-FSP1/S100A4 100 æg

Glycine amidinotransferase (GATM) is expressed in the kidneys, liver, brain, lungs, salivary glands and skeletal muscles. The gene encoding it is localized on human chromosome 15.

Immunogen guanine nucleotide binding protein-like 3 (nucleolar) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen golgi reassembly stacking protein 2, 55kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen G protein-coupled receptor 109B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLuK1 to GLuK5.

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLUK1 to GLUK5.

Immunogen Recombinant protein corresponding to glutamate ionotropic receptor kainate type subunit 4 Sequence LWTLRHSEATEVSVCQEMVTELRSIILCQDSIH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Recombinant protein corresponding to guanylate kinase 1. Sequence GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen erb-b2 receptor tyrosine kinase 2 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) Biochem/physiol Actions Receptor