Antiviral drugs

ITGA2B (integrin subunit &#945 2b) is mapped to human chromosome 17q21.31.

Integrin &#9453 (ITGA3) belongs to the integrin family. It is expressed in various parts of the developing kidney, like undifferentiated metanephric mesenchyme (MM), primary vesicles, S-shaped bodies and developing tubules.

Integrin &#945-6 (ITGA6) belongs to the integrin superfamily and is expressed in epithelial cells. The gene encoding it is present on chromosome 2q.

Immunogen Recombinant protein corresponding to integrin subunit beta 1 Sequence KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to integrin subunit beta 1 Sequence FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Keratocan (KERA) is an extracellular matrix protein that belongs to the small, leucine-rich, proteoglycan family (SLRP). It is expressed in the cornea and bone.

Specificity The antibody reacts with the 64 kDa polypeptide (cytokeratin 3 Keratin K3) of corneal epithelium and keratin K76 (cytokeratin K2p) of palate epithelium. As such this represents an excellent marker for studying corneal epithelial-type

Cytokeratin 3, also known as 65kDa Cytokeratin or Keratin K3 is a specific keratin found primarily in the corneal epithelium and minorly in other epithelium like that of the esophagus. The corneal epithelium tissue forms the outermost layer of the

KIDINS220 (kinase D-interacting substrate, 220kDa) is a newly discovered protein, which has a predominant expression in the developing nervous system. This gene is localized to human chromosome 2q.

KV3.2 is a potassium voltage-gated channel expressed in neurons.

Immunogen UPF0404 protein C11orf59 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Synthetic peptide directed towards the N terminal of human LASS4 Biochem/physiol Actions LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing