Antiviral drugs

Homeobox protein Meis1 (UniProt: Q60954-1 P97367-2 and P97367-3 also known as Myeloid ecotropic viral integration site 1 (Meis1) and Meis1-related protein 1) is encoded by the Meis1 gene (Gene ID: 17268). Meis proteins act as transcription

Immunogen mortality factor 4 like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Integrin alphaV, also known as CD51, a member of the integrin family, is a 140 kD protein expressed on activated T cells, polymorphonuclear granulocytes, blastocysts, and osteoclasts. Integrin alphaV forms heterodimers by association with integrins

Immunogen Mov10 RISC complex RNA helicase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen MPV17 mitochondrial membrane protein-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to myosin heavy chain 9 Sequence LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen neuron navigator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

NDUFV3 (NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa) is a regulatory component of mitochondrial complex. It has a molecular mass of 10kDa and it encodes NADH dehydrogenase.

NADH:ubiquinone oxidoreductase subunit V3 (NDUFV3) is part of the mitochondrial NADH:ubiquinone oxidoreductase (Complex I). The gene encoding this protein is localized on human chromosome 21q22.

Immunogen NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project