Antiviral drugs

Immunogen Neuronal growth regulator 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen NEL-like 1 (chicken) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen neural EGFL like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Ninein (UniProt Q61043 also known as Glycogen synthase kinase 3 beta-interacting protein, GSK3B-interacting protein) is encoded by the Nin (also known as Kiaa1565) gene (Gene ID 18080) in murine species. Ninein is a microtubule (MT)

Immunogen Synthetic peptide directed towards the middle region of human NKIRAS2 Application Anti-NKIRAS2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions NKIRAS2 (NFKB

Immunogen Recombinant protein corresponding to NK3 homeobox 1 Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

N-methyl-D-aspartate receptor subunit NR1 (NMDAR1) is a multi-pass membrane protein belonging to the glutamate-gated ion channel family and is one of two subunits comprising the tetrameric protein NMDAR localized throughout the brain at excitatory

N-methyl-D-aspartate Receptors (NMDAR) are one of three pharmacologically distinct subtypes of ionotropic receptors that mediate a majority of excitatory neurotransmission in the brain via the endogenous amino acid, L-glutamate. MDARs form

Specificity Specific for the NMDAR1 C2 splice variants. Recognizes NMDAR-1a, 1b, 2a, and 2b NR1 splice variants.

Specificity Specific for the NMDAR1 containing the C2&#8242 splice variant insert. The antibody does not recognize the NMDAR1 subunits of the NMDA receptor that do not contain the C2&#8242 insert.

Immunogen Recombinant protein corresponding to nicotinamide nucleotide adenylyltransferase 2 Sequence LLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVD Application All Prestige Antibodies Powered by Atlas

Immunogen Neuronal PAS domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a