Antiviral drugs

COUP transcription factor 2 (UniProt: P24468-2 also known as COUP-TF2, COUP-TF II, Apolipoprotein A-I regulatory protein 1, ARP-1, COUP transcription factor II, COUP-TF II, Nuclear receptor subfamily 2 group F member 2) is encoded by the NR2F2

Immunogen nucleoporin 153kDa recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) Features

Immunogen oral cancer overexpressed 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen oviductal glycoprotein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen oviductal glycoprotein 1, 120kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Tumor suppressor ARF (UniProt Q8N726 also known as Alternative reading frame, ARF, Cyclin-dependent kinase inhibitor 2A, p14ARF, p19ARF) is encoded by the CDKN2A (also known as CDKN2, MLM) gene (Gene ID 1029) in human. p14ARF acts as a tumor

PAXIP1-associated glutamate-rich protein 1 (UniProt: Q9BTK6 also known as Glutamate-rich co-activator interacting with SRC1, GAS, PAXIP1-associated protein 1, PTIP-associated protein 1) is encoded by the PAGR1 (also known as C16orf53, PA1) gene

Immunogen prostate and breast cancer overexpressed 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Peptide YY (UniProt P10082 also known as Peptide tyrosine tyrosine, PYY, PYY-I) is encoded by the PYY (also known as PYY1) gene (Gene ID 5697) in human. Peptide YY is initially produced as a preproprotein with a signal and a propeptide sequence

Immunogen Synthetic peptide directed towards the N terminal region of human PGBD3 Sequence Synthetic peptide located within the following region: NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPP Physical form Purified antibody supplied in 1x PBS

Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (UniProt: O70343 also known as PGC-1-alpha, PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha) is encoded by the Ppargc1a (also known as Pgc1, Pgc1a, Ppargc1) gene (Gene ID: 19017)