Antiviral drugs

Plasmalemma vesicle associated protein (PLVAP) is a rod-like type II membrane amino-glycosylated glycoprotein with molecular mass of 60kDa. It consists of a short intracellular tail and a long extracellular domain.

PR domain proteins (PRDMs) have been associated with many types of human cancers. PRDM14 was found to be up-regulated in breast cancer cells.

PRDM14 is an approximately 65 kDa transcriptional inhibitor that contains one histone methylating PR/SET domain (aa 266 - 367) and six zinc finger repeats (aa 400 - 568). PRDM14 is preferentially expressed in germ cells and undifferentiated

Immunogen protein kinase D3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen protein kinase, DNA-activated, catalytic polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to prostate tumor overexpressed 1 Sequence WSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Polymerase I and transcript release factor (UniProt Q6NZI2 also known as Cavin-1, PTRF, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12) is encoded by the PTRF (also known as CGL4, CAVIN, CAVIN1, FKSG13) gene (Gene ID

Polymerase I and transcript release factor (PTRF), also known as &#8220cavin-1,&#8221 is a small cytoplasmic protein, which interacts with caveolin-1 to assemble specialized membrane invaginations (or caveolae), in various types of cells.

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 19 Sequence PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 19 Sequence QPLPSCEVCATPSPEEVQSWAQSFDKL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen RIB43A domain with coiled-coils 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen RIB43A-like with coiled-coils protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a