-
Add to Cart The item has been addedABS1587Anti-Ribophorin I/RPN-I Antibody (C15-1317-734)
Price: $713.14List Price: $792.38Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 (EC 2.4. -
Add to Cart The item has been addedHPA041314-25ULANTI-RILPL1
Price: $540.00List Price: $600.00Immunogen Rab interacting lysosomal protein-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA041314-100ULAnti-RILPL1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Rab interacting lysosomal protein-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA028958-100ULAnti-RILPL2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Rab interacting lysosomal protein-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA066812-25ULANTI-RP11-80H18.3
Price: $540.00List Price: $600.00Immunogen Hydroxyacyl-thioester dehydratase type 2, mitochondrial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA063217-25ULANTI-RPS19
Price: $540.00List Price: $600.00Immunogen Recombinant protein corresponding to ribosomal protein S19 Sequence LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA047426-100ULAnti-RRNAD1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ribosomal RNA adenine dimethylase domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA056416-25ULANTI-RYR1
Price: $540.00List Price: $600.00Immunogen ryanodine receptor 1 (skeletal) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA042745-25ULANTI-S100A11
Price: $540.00List Price: $600.00Immunogen S100 calcium binding protein A11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA042674-100ULANTI-S100A3
Price: $928.29List Price: $1,031.43Immunogen S100 calcium binding protein A3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA007973-25ULANTI-S100A4
Price: $540.00List Price: $600.00Rabbit polyclonal anti-S100A4 antibody reacts with human S100 calcium-binding protein A4. S100 calcium-binding protein A4 (S100A4) is a member of the S100 family of calcium binding proteins. -
Add to Cart The item has been addedHPA004193-25ULANTI-S100A9
Price: $540.00List Price: $600.00S100A9 is a small calcium-binding protein belonging to the low-molecular weight S100 protein family. It is highly expressed in the neutrophil, monocyte cytosol and adipose tissues.
