Aciclovir or acyclovir

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including MSDS and any product information leaflets have been developed and issued under the Authority of the

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including MSDS and any product information leaflets have been developed and issued under the Authority of the

Immunogen Synthetic peptide directed towards the N terminal region of human ACADVL Application Anti-ACADVL antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions The protein encoded

The gene ACADVL (acyl-CoA dehydrogenase, very long chain) is mapped to human chromosome 17p13.1.

Very long-chain specific acyl-CoA dehydrogenase (ACADVL) exists as a homodimer. It possesses around 180 amino acids at its C-terminal which helps it to bind to proteins.

Immunogen Recombinant protein corresponding to acyl-CoA thioesterase 2 Sequence MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

The gene ACOT7 (acyl-CoA thioesterase 7) is highly expressed in the brain and testis, and is mapped to human chromosome 1p36. This gene produces many isoforms due to alternate splicing.

The gene ACOT7 (acyl-CoA thioesterase 7) is highly expressed in the brain and testis, and is mapped to human chromosome 1p36. This gene produces many isoforms due to alternate splicing.

Immunogen acrosin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Synthetic peptide directed towards the N terminal region of human ACRV1 Biochem/physiol Actions ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during

Immunogen acrosomal vesicle protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen acyl-CoA synthetase bubblegum family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive