Adefovir

Immunogen Recombinant protein corresponding to prostate tumor overexpressed 1 Sequence WSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

It is an isotopically labelled solution of AOZ, also known as 3-amino-2-oxazolidinone, a metabolite of the synthetic nitrofuran veterinary antibiotic&#8213 furazolidone. Application The analytical standard can be used as an internal standard for

HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IF APPLICATIONS: SkiP antibody can be used for detection of Ski by Western blot at 1 - 2 &#956g/mL. Antibody can also be used for immunohistochemistry starting at 20 &#956g/mL.