-
HPA078597-100UL
Anti-ALOXE3
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to arachidonate lipoxygenase 3 Sequence YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
927589-50MG
ARVS-ALKYNE (C15-1313-305)
Price: $560.57List Price: $622.86Application ArVS-alkyne is a Michael acceptor probe that can be used to label cysteines. A method was developed using cysteine-reactive compounds including this one to allow for unbiased analysis of proteomic data in quantitative applications . -
927597-50MG
ARVSA-ALKYNE (C15-1313-306)
Price: $312.86List Price: $347.62Application ArVSA-alkyne is a Michael acceptor probe that can be used to label cysteines. A method was developed using cysteine-reactive compounds including this one to allow for unbiased analysis of proteomic data in quantitative applications . -
A003-05
Avidin Alk Phos 1mg
Price: $386.04List Price: $428.93Avidin Alkaline Phosphatase Conjugated is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting.