Antiviral aldehydes

CH₃C&equivCCH(OC₂H₅)₂ CAS#: 2806-97-5 F.W.: 142.20 Requires refrigeration.

Structure confirmed. Will ship with Certificate of Analysis (CoA)

Application 3-Hydroxybenzaldehyde can be used as a reactant along with ethyl acetoacetate and thiourea in the synthesis of corresponding dihydropyrimidine-2-thione (monastrol), using Yb(OTf) 3 as a catalyst by Biginelli cyclocondensation reaction.

Application 3-Hydroxybenzaldehyde can be used as a reactant along with ethyl acetoacetate and thiourea in the synthesis of corresponding dihydropyrimidine-2-thione (monastrol), using Yb(OTf) 3 as a catalyst by Biginelli cyclocondensation reaction.

Application 3-Hydroxybenzaldehyde can be used as a reactant along with ethyl acetoacetate and thiourea in the synthesis of corresponding dihydropyrimidine-2-thione (monastrol), using Yb(OTf) 3 as a catalyst by Biginelli cyclocondensation reaction.

Analysis Note Assay (GC, area%): &#8805 97.0 % (a/a) Melting range (lower value): &#8805 28 &#176C Melting range (upper value): &#8804 33 &#176C Identity (IR): passes test Due to its specific melting range the product may be solid, liquid, a

Analysis Note Assay (GC, area%): &#8805 97.0 % (a/a) Melting range (lower value): &#8805 28 &#176C Melting range (upper value): &#8804 33 &#176C Identity (IR): passes test Due to its specific melting range the product may be solid, liquid, a

Analysis Note Assay (GC, area%): &#8805 97.0 % (a/a) Melting range (lower value): &#8805 28 &#176C Melting range (upper value): &#8804 33 &#176C Identity (IR): passes test Due to its specific melting range the product may be solid, liquid, a

Cubilin (UniProt O60494 also known as 460 kDa receptor, Intestinal intrinsic factor receptor, Intrinsic factor-cobalamin receptor, Intrinsic factor-vitamin B12 receptor) is encoded by the CUBN (also known as IFCR, MGA1) gene (Gene ID 8029) in

Immunogen Recombinant protein corresponding to cubilin Sequence SDQGFHITYLTSPSDLRCGGNYTDPEGELFLPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCGNGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGE Application All Prestige

Endrin aldehyde can be obtained as an oxidation product of the pesticide endrin , upon exposure to light or heat. Endrin aldehyde is an organochlorine type of pesticide.

Structure confirmed. Purity = 98%. Will ship with Certificate of Analysis (CoA)