-
Add to Cart The item has been added110514660012'-DEOXY-GUANOSINE-5'-TP SOLUTION
Price: $182.12List Price: $202.362′-Deoxyguanosine 5′-triphosphate (dGTP) is made of a guanine nucleobase attached to deoxyribose and a 5′-hydroxyl on the sugar linked to a chain of three phosphate residues. It is used by the cells for the synthesis of DNA with the -
Add to Cart The item has been addedHPA026077-25ULANTI-GATM
Price: $540.00List Price: $600.00Glycine amidinotransferase (GATM) is expressed in the kidneys, liver, brain, lungs, salivary glands and skeletal muscles. The gene encoding it is localized on human chromosome 15. -
Add to Cart The item has been addedHPA036743-25ULANTI-GNL3
Price: $540.00List Price: $600.00Immunogen guanine nucleotide binding protein-like 3 (nucleolar) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA046878-100Anti-GOLGA7 golgin A7, 100ul UN 1687 6.1 PG2
Price: $957.50List Price: $1,063.89Anti-GOLGA7 golgin A7, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA046878-25Anti-GOLGA7 golgin A7, 25ul UN 1687 6.1 PG2
Price: $718.81List Price: $798.67Anti-GOLGA7 golgin A7, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA014395-25ULANTI-GRIK2 (C15-1448-127)
Price: $540.00List Price: $600.00GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLuK1 to GLuK5. -
Add to Cart The item has been addedHPA014623-25ULANTI-GRIK2 (C15-1448-197)
Price: $540.00List Price: $600.00GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLUK1 to GLUK5. -
Add to Cart The item has been addedHPA074453-100ULAnti-GRIK4
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to glutamate ionotropic receptor kainate type subunit 4 Sequence LWTLRHSEATEVSVCQEMVTELRSIILCQDSIH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA028118-100ULAnti-GUK1
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to guanylate kinase 1. Sequence GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA067102-100ULAnti-PGM5
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to phosphoglucomutase 5 Sequence KDGLWAVLVWLSIIAARKQSVEEIVRDHWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been added616-1002Donkey IgG TRITC Conjugated 2mg (C08-0581-636)
Price: $274.48List Price: $304.97This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial -
Add to Cart The item has been added616-4002Donkey IgG TRITC Conjugated 2mg (C08-0581-779)
Price: $299.59List Price: $332.88This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial
