Citenazone

2-NP-AOZ is a 2-nitrophenyl derivative&nbspof the tissue-bound metabolite, 3-amino-2-oxazolidinone (AOZ). Application 2-NP-AOZ may be used as a reference standard for the determination of 2-NP-AOZ in aquatic animals using enzyme linked

Immunogen Recombinant protein corresponding to nicotinamide nucleotide adenylyltransferase 2 Sequence LLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVD Application All Prestige Antibodies Powered by Atlas

A cell-permeable quinazoline compound that targets the ATP binding pocket and an adjacent cleft and acts as a potent and reversible inhibitor of Aurora A and Aurora B (IC 50 = 110 and 130 nM, respectively) with moderate to excellent selectivity

BARB UNION PP 1/2 ID 10/PK

MeDbz NovaSyn TGR resin is a second generation Dbz resin that overcomes the problem of branched peptide formation of the original and provides a robust approach to the synthesis of peptide thioesters by Fmoc SPPS. This product is used exactly in

Individual synthetic microRNA inhibitors were designed using a proprietary algorithm, which is based on the work of Haraguchi, T, et al. and in collaboration with Dr.

Individual synthetic microRNA inhibitors were designed using a proprietary algorithm, which is based on the work of Haraguchi, T, et al. and in collaboration with Dr.

Application VenPure &#174 SF (Sodium borohydride powder) is a mild reducing agent used in the reduction of aldehydes and ketones to their corresponding alcohols. It is generally inert to other functional groups such as epoxides, esters, nitriles

Application VenPure &#174 SF (Sodium borohydride powder) is a mild reducing agent used in the reduction of aldehydes and ketones to their corresponding alcohols. It is generally inert to other functional groups such as epoxides, esters, nitriles