Elvitegravir

Immunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen Recombinant protein corresponding to endogenous retrovirus group 3, member 1 Sequence QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA Application All

ESYT2 (extended synaptotagmin protein 2), membrane-anchored extended synaptotagmin-like protein, belongs to the family of multi-C 2 domain membrane proteins. It is composed of an N-terminal transmembrane domain, a central juxtamembranous domain and

Immunogen ETS translocation variant 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen ETS variant 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Ets variant gene 6 (ETV6) is mapped to human chromosome 12p13. ETV6 protein consists of two domains namely, the HLH (helix-loop-helix) domain and the ETS (E26 transformation-specific) domain encoded by exons 3 and 4 and exons 6 through 8,

Immunogen Synthetic peptide directed towards the C terminal region of human ETV7 Biochem/physiol Actions ETV7 belongs to the ETS family of transcription factors that are important in development, differentiation and oncogenesis. It is predominantly

Immunogen ets variant 7 recombinant protein epitope signature tag (PrEST) Application Anti-ETV7 has been used in western blotting and immunohistochemistry. Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively

Immunogen Recombinant protein corresponding to ETS variant 7 Sequence EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Leucine-rich repeat containing G protein-coupled receptor 5 (LGR5) is a seven-transmembrane G-protein coupled receptor. It belongs to the family of glycoprotein hormone receptor family.

A benzoxazinone compound that acts as a potent inhibitor of human leukocyte elastase (IC 50 = 29.5 nM), likely by covalently modifying active site serine via a Michael addition-elimination reaction.