-
Add to Cart The item has been addedHPA067222-100ULAnti-ACAD10 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen acyl-CoA dehydrogenase family, member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA053905-25ULANTI-EMC10
Price: $540.00List Price: $600.00Immunogen ER membrane protein complex subunit 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been added801121Anti-HIV Type 1 gp41 Clone 10E9 (1 mg)
Price: $1,946.29List Price: $2,162.54Antibody dilutions should be prepared using buffers containing suitable protein in order to stabilize antibody activity. -
Add to Cart The item has been addedHPA042795-100ULANTI-MED10
Price: $928.29List Price: $1,031.43Immunogen mediator complex subunit 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedCBL1346Z-IAnti-mouse Integrin alphaV Antibody, clone RMV-7 (Preservative free)
Price: $785.14List Price: $872.38Integrin alphaV, also known as CD51, a member of the integrin family, is a 140 kD protein expressed on activated T cells, polymorphonuclear granulocytes, blastocysts, and osteoclasts. Integrin alphaV forms heterodimers by association with integrins -
Add to Cart The item has been addedHPA064783-100ULAnti-MYH9
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to myosin heavy chain 9 Sequence LEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA042745-25ULANTI-S100A11
Price: $540.00List Price: $600.00Immunogen S100 calcium binding protein A11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA004193-25ULANTI-S100A9
Price: $540.00List Price: $600.00S100A9 is a small calcium-binding protein belonging to the low-molecular weight S100 protein family. It is highly expressed in the neutrophil, monocyte cytosol and adipose tissues. -
Add to Cart The item has been addedZ02708-10IL-11, Human,10ug
Price: $307.36List Price: $341.51Interleukin 11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1ยช-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T1165. IL-11 was -
Add to Cart The item has been addedAPrEST81604-100PrEST Antigen ARHGAP11A Rho GTPase activating protein 11A, 1 (C08-0215-354)
Price: $537.65List Price: $597.39PrEST Antigen ARHGAP11A Rho GTPase activating protein 11A, 1 -
Add to Cart The item has been addedAPrEST81605-100PrEST Antigen ARHGAP11A Rho GTPase activating protein 11A, 1 (C08-0215-355)
Price: $537.65List Price: $597.39PrEST Antigen ARHGAP11A Rho GTPase activating protein 11A, 1 -
Add to Cart The item has been addedAPrEST94932-100PrEST Antigen ARHGAP11A Rho GTPase activating protein 11A, 1 (C08-0226-515)
Price: $537.65List Price: $597.39PrEST Antigen ARHGAP11A Rho GTPase activating protein 11A, 1
