-
Add to Cart The item has been addedHPA071026-100Anti-CD36 CD36 molecule, 100ul UN 1687 6.1 PG2
Price: $957.50List Price: $1,063.89Anti-CD36 CD36 molecule, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA071026-25Anti-CD36 CD36 molecule, 25ul UN 1687 6.1 PG2
Price: $718.81List Price: $798.67Anti-CD36 CD36 molecule, 25ul UN 1687 6.1 PG2 -
Add to Cart The item has been addedHPA054959-25ULANTI-FASLG
Price: $540.00List Price: $600.00Immunogen Fas ligand (TNF superfamily, member 6) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA078571-100ULAnti-NKX3-1
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to NK3 homeobox 1 Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA036662-25ULANTI-PDS5A
Price: $540.00List Price: $600.00Immunogen PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA066812-25ULANTI-RP11-80H18.3
Price: $540.00List Price: $600.00Immunogen Hydroxyacyl-thioester dehydratase type 2, mitochondrial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been added1269174-20MGFamciclovir Related Compound A
Price: $2,274.73List Price: $2,527.47This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the -
Add to Cart The item has been added1269185-20MGFamciclovir Related Compound B
Price: $2,274.73List Price: $2,527.47This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the -
Add to Cart The item has been added1269196-20MGFamciclovir Related Compound C
Price: $2,159.34List Price: $2,399.27This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the -
Add to Cart The item has been added1269141-25MGFamciclovir Related Compound F
Price: $2,456.04List Price: $2,728.94This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the -
-
Add to Cart The item has been added1199950003PHARMPREP P 100 RP-18E 10â•¡M 1 PC
Price: $3,309.89List Price: $3,677.66Analysis Note Carbon content: 17 - 21 % Purity (Al): ≤ 50 ppm Purity (Fe): ≤ 25 ppm Purity (Na): ≤ 25 ppm Extractable matter: ≤ 0.10 % Specific surface area (BET): 320 - 400 m²/g Pore volume: 0.
