-
M735633-1g
Aladdin
7-Methoxy-4,4-dimethylisochroman-1,3-dione (C09-1601-458)
Price: $205.35List Price: $228.177-Methoxy-4,4-dimethylisochroman-1,3-dione. -
M735633-250mg7-Methoxy-4,4-dimethylisochroman-1,3-dione.
-
HPA054959-25ULImmunogen Fas ligand (TNF superfamily, member 6) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA078571-100ULImmunogen Recombinant protein corresponding to NK3 homeobox 1 Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and
-
HPA036662-25ULImmunogen PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
-
HPA066812-25ULImmunogen Hydroxyacyl-thioester dehydratase type 2, mitochondrial Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
A638857-1mgProduct introduction:Our :Rhodamine Redâ„¢-X conjugate of NeutrAvidinâ„¢ biotin-binding protein: - a form of avidin that has been processed to remove carbohydrate and to lower its isoelectric point - can substantially decrease background due to
-
1269174-20MGThis product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
1269185-20MGThis product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
1269196-20MGThis product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
1269141-25MGThis product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the
-
10818-15FRCPS PEAN STNDRD GRADE CRVD 7