Fosamprenavir calcium

Immunogen Recombinant protein corresponding to CDK2-associated, cullin domain 1. Sequence ASSTININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

The scaffolding protein is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting

Immunogen caveolin 1, caveolae protein, 22kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen caveolin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Specificity Recognizes a 1B subunit (both LMW and HMW forms) of voltage-gated calcium channel. Does not cross react with any other calcium channel antigens tested so far.

Immunogen Synthetic peptide directed towards the N terminal region of human CAV3 Application Anti-CAV3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 &#956g/ml.

Immunogen caveolin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Specificity Recognizes Ca v 3.2 (&#9451H (T-Type)).

Specificity Recognizes Ca v 3.2 (&#9451H (T-Type)).

Polymerase I and transcript release factor (UniProt Q6NZI2 also known as Cavin-1, PTRF, RNA polymerase I and transcript release factor, TTF-I interacting peptide 12) is encoded by the PTRF (also known as CGL4, CAVIN, CAVIN1, FKSG13) gene (Gene ID

Polymerase I and transcript release factor (PTRF), also known as &#8220cavin-1,&#8221 is a small cytoplasmic protein, which interacts with caveolin-1 to assemble specialized membrane invaginations (or caveolae), in various types of cells.

Specificity Recognizes rat Sodium Calcium Exchanger 1 (NCX1). The immunogen shows no significant sequence homology with other NCX proteins.